SCOPe 2.04: Domain d2ojef2: 2oje F:1-92

Lineage for d2ojef2 (2oje F:1-92)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (9 PDB entries)

8. Domain d2ojef2: 2oje F:1-92 [139111]
   Other proteins in same PDB: d2ojea1, d2ojea2, d2ojeb1, d2ojed1, d2ojee1, d2ojee2, d2ojef1, d2ojeh1
   automatically matched to d1d5xb2
   complexed with po4

Details for d2ojef2

PDB Entry: 2oje, 3 Å

PDB Description: Mycoplasma arthritidis-derived mitogen complexed with class II MHC molecule HLA-DR1/HA complex in the presence of EDTA

PDB Compounds: (F:) HLA class II histocompatibility antigen, DRB1-1 beta chain precursor

SCOPe Domain Sequences for d2ojef2:

Sequence; same for both SEQRES and ATOM records:

>d2ojef2 d.19.1.1 (F:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

Timeline for d2ojef2:

• d2ojef2 first appeared in SCOP 1.73
  
• d2ojef2 appears in SCOPe 2.03
  
• d2ojef2 appears in SCOPe 2.05
  
• d2ojef2 appears in the current release, SCOPe 2.08