Lineage for d2ojef2 (2oje F:1-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938367Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2938433Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (9 PDB entries)
  8. 2938444Domain d2ojef2: 2oje F:1-92 [139111]
    Other proteins in same PDB: d2ojea1, d2ojea2, d2ojeb1, d2ojed1, d2ojee1, d2ojee2, d2ojef1, d2ojeh1
    automatically matched to d1d5xb2
    complexed with po4

    fragment; missing more than one-third of the common structure and/or sequence

Details for d2ojef2

PDB Entry: 2oje (more details), 3 Å

PDB Description: Mycoplasma arthritidis-derived mitogen complexed with class II MHC molecule HLA-DR1/HA complex in the presence of EDTA
PDB Compounds: (F:) HLA class II histocompatibility antigen, DRB1-1 beta chain precursor

SCOPe Domain Sequences for d2ojef2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ojef2 d.19.1.1 (F:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d2ojef2:

Click to download the PDB-style file with coordinates for d2ojef2.
(The format of our PDB-style files is described here.)

Timeline for d2ojef2: