Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries) Uniprot P04229 30-219 probably orthologous to the mouse I-E group |
Domain d2ojef1: 2oje F:93-190 [139110] Other proteins in same PDB: d2ojea1, d2ojea2, d2ojeb2, d2ojed1, d2ojee1, d2ojee2, d2ojef2, d2ojeh1 automatically matched to d1d5xb1 complexed with po4 |
PDB Entry: 2oje (more details), 3 Å
SCOPe Domain Sequences for d2ojef1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ojef1 b.1.1.2 (F:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd wtfqtlvmletvprsgevytcqvehpsvtspltvewra
Timeline for d2ojef1: