SCOPe 2.05: Domain d2ojee2: 2oje E:13-81

Lineage for d2ojee2 (2oje E:13-81)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (13 PDB entries)

8. Domain d2ojee2: 2oje E:13-81 [139109]
   Other proteins in same PDB: d2ojea1, d2ojeb1, d2ojeb2, d2ojed1, d2ojee1, d2ojef1, d2ojef2, d2ojeh1
   automatically matched to d1k2da2
   complexed with po4

Details for d2ojee2

PDB Entry: 2oje, 3 Å

PDB Description: Mycoplasma arthritidis-derived mitogen complexed with class II MHC molecule HLA-DR1/HA complex in the presence of EDTA

PDB Compounds: (E:) HLA class II histocompatibility antigen, DR alpha chain precursor

SCOPe Domain Sequences for d2ojee2:

Sequence; same for both SEQRES and ATOM records:

>d2ojee2 d.19.1.1 (E:13-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalaniavdkanlei
mtkrsnytp

Timeline for d2ojee2:

• d2ojee2 first appeared in SCOP 1.73
  
• d2ojee2 appears in SCOPe 2.04
  
• d2ojee2 appears in SCOPe 2.06
  
• d2ojee2 appears in the current release, SCOPe 2.08