Lineage for d2ojee1 (2oje E:83-179)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760280Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 1760346Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (25 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 1760367Domain d2ojee1: 2oje E:83-179 [139108]
    Other proteins in same PDB: d2ojea2, d2ojeb1, d2ojeb2, d2ojed1, d2ojee2, d2ojef1, d2ojef2, d2ojeh1
    automatically matched to d1k2da1
    complexed with po4

Details for d2ojee1

PDB Entry: 2oje (more details), 3 Å

PDB Description: Mycoplasma arthritidis-derived mitogen complexed with class II MHC molecule HLA-DR1/HA complex in the presence of EDTA
PDB Compounds: (E:) HLA class II histocompatibility antigen, DR alpha chain precursor

SCOPe Domain Sequences for d2ojee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ojee1 b.1.1.2 (E:83-179) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpred
hlfrkfhylpflpstedvydcrvehwgldepllkhwe

SCOPe Domain Coordinates for d2ojee1:

Click to download the PDB-style file with coordinates for d2ojee1.
(The format of our PDB-style files is described here.)

Timeline for d2ojee1: