Lineage for d2ojeb2 (2oje B:1-92)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897932Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1897994Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (9 PDB entries)
  8. 1898004Domain d2ojeb2: 2oje B:1-92 [139106]
    Other proteins in same PDB: d2ojea1, d2ojea2, d2ojeb1, d2ojed1, d2ojee1, d2ojee2, d2ojef1, d2ojeh1
    automatically matched to d1d5xb2
    complexed with po4

Details for d2ojeb2

PDB Entry: 2oje (more details), 3 Å

PDB Description: Mycoplasma arthritidis-derived mitogen complexed with class II MHC molecule HLA-DR1/HA complex in the presence of EDTA
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain precursor

SCOPe Domain Sequences for d2ojeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ojeb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d2ojeb2:

Click to download the PDB-style file with coordinates for d2ojeb2.
(The format of our PDB-style files is described here.)

Timeline for d2ojeb2: