![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
![]() | Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (9 PDB entries) |
![]() | Domain d2ojeb2: 2oje B:1-92 [139106] Other proteins in same PDB: d2ojea1, d2ojea2, d2ojeb1, d2ojed1, d2ojee1, d2ojee2, d2ojef1, d2ojeh1 automatically matched to d1d5xb2 complexed with po4 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2oje (more details), 3 Å
SCOPe Domain Sequences for d2ojeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ojeb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]} gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey wnsqkdlleqrraavdtycrhnygvgesftvq
Timeline for d2ojeb2: