Lineage for d2ojea1 (2oje A:83-179)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654849Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 654899Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (20 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 654919Domain d2ojea1: 2oje A:83-179 [139103]
    Other proteins in same PDB: d2ojea2, d2ojeb1, d2ojeb2, d2ojed1, d2ojee2, d2ojef1, d2ojef2, d2ojeh1
    automatically matched to d1k2da1
    complexed with po4

Details for d2ojea1

PDB Entry: 2oje (more details), 3 Å

PDB Description: Mycoplasma arthritidis-derived mitogen complexed with class II MHC molecule HLA-DR1/HA complex in the presence of EDTA
PDB Compounds: (A:) HLA class II histocompatibility antigen, DR alpha chain precursor

SCOP Domain Sequences for d2ojea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ojea1 b.1.1.2 (A:83-179) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpred
hlfrkfhylpflpstedvydcrvehwgldepllkhwe

SCOP Domain Coordinates for d2ojea1:

Click to download the PDB-style file with coordinates for d2ojea1.
(The format of our PDB-style files is described here.)

Timeline for d2ojea1: