Lineage for d2oj9a1 (2oj9 A:954-1256)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874901Protein Insulin-like growth factor 1 receptor [69825] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 874902Species Human (Homo sapiens) [TaxId:9606] [69826] (6 PDB entries)
  8. 874909Domain d2oj9a1: 2oj9 A:954-1256 [139102]
    automatically matched to d1m7na_
    complexed with bmi

Details for d2oj9a1

PDB Entry: 2oj9 (more details), 2 Å

PDB Description: Structure of IGF-1R kinase domain complexed with a benzimidazole inhibitor
PDB Compounds: (A:) Insulin-like growth factor 1 receptor precursor (EC 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD221 antigen)

SCOP Domain Sequences for d2oj9a1:

Sequence, based on SEQRES records: (download)

>d2oj9a1 d.144.1.7 (A:954-1256) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
advyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmre
rieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemennpv
lappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyet
dyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlr
fvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyse
enk

Sequence, based on observed residues (ATOM records): (download)

>d2oj9a1 d.144.1.7 (A:954-1256) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
advyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmre
rieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpeppslsk
miqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyrkggk
gllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmeggll
dkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk

SCOP Domain Coordinates for d2oj9a1:

Click to download the PDB-style file with coordinates for d2oj9a1.
(The format of our PDB-style files is described here.)

Timeline for d2oj9a1: