![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Splicesomal U1A protein [54932] (2 species) duplication: contains two domains of this fold |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54933] (54 PDB entries) Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98 |
![]() | Domain d2oiha_: 2oih A: [139100] automated match to d1auda_ protein/RNA complex; complexed with tl; mutant |
PDB Entry: 2oih (more details), 2.4 Å
SCOPe Domain Sequences for d2oiha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oiha_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs satnalrsmqgfpfydkpmriqyaktdsdiiakmk
Timeline for d2oiha_: