Class a: All alpha proteins [46456] (286 folds) |
Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
Family a.204.1.2: MazG-like [116993] (3 proteins) Pfam PF03819 |
Protein XTP3-transactivated gene A protein homolog RS21-C6 [140792] (1 species) confirmed prediction of the m5dCTPase activity |
Species Mouse (Mus musculus) [TaxId:10090] [140793] (4 PDB entries) Uniprot Q9QY93 22-134 |
Domain d2oigd1: 2oig D:21-124 [139099] complexed with 523 |
PDB Entry: 2oig (more details), 3.3 Å
SCOPe Domain Sequences for d2oigd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oigd1 a.204.1.2 (D:21-124) XTP3-transactivated gene A protein homolog RS21-C6 {Mouse (Mus musculus) [TaxId: 10090]} rpfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwksdtepg pqawppkeraalqeelsdvliylvalaarchvdlpqaviskmdt
Timeline for d2oigd1: