SCOPe 2.05: Domain d2oigd1: 2oig D:21-124

Lineage for d2oigd1 (2oig D:21-124)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.2: MazG-like [116993] (3 proteins)
   Pfam PF03819

6. Protein XTP3-transactivated gene A protein homolog RS21-C6 [140792] (1 species)
   confirmed prediction of the m5dCTPase activity

7. Species Mouse (Mus musculus) [TaxId:10090] [140793] (4 PDB entries)
   Uniprot Q9QY93 22-134

8. Domain d2oigd1: 2oig D:21-124 [139099]
   complexed with 523

Details for d2oigd1

PDB Entry: 2oig, 3.3 Å

PDB Description: crystal structure of rs21-c6 core segment and dm5ctp complex

PDB Compounds: (D:) rs21-c6

SCOPe Domain Sequences for d2oigd1:

Sequence; same for both SEQRES and ATOM records:

>d2oigd1 a.204.1.2 (D:21-124) XTP3-transactivated gene A protein homolog RS21-C6 {Mouse (Mus musculus) [TaxId: 10090]}
rpfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwksdtepg
pqawppkeraalqeelsdvliylvalaarchvdlpqaviskmdt

Timeline for d2oigd1:

• d2oigd1 first appeared in SCOP 1.73
  
• d2oigd1 appears in SCOPe 2.04
  
• d2oigd1 appears in SCOPe 2.06
  
• d2oigd1 appears in the current release, SCOPe 2.08