Lineage for d2oigd1 (2oig D:21-124)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736411Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 2736412Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 2736425Family a.204.1.2: MazG-like [116993] (4 proteins)
    Pfam PF03819
  6. 2736435Protein XTP3-transactivated gene A protein homolog RS21-C6 [140792] (1 species)
    confirmed prediction of the m5dCTPase activity
  7. 2736436Species Mouse (Mus musculus) [TaxId:10090] [140793] (4 PDB entries)
    Uniprot Q9QY93 22-134
  8. 2736448Domain d2oigd1: 2oig D:21-124 [139099]
    complexed with 523

Details for d2oigd1

PDB Entry: 2oig (more details), 3.3 Å

PDB Description: crystal structure of rs21-c6 core segment and dm5ctp complex
PDB Compounds: (D:) rs21-c6

SCOPe Domain Sequences for d2oigd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oigd1 a.204.1.2 (D:21-124) XTP3-transactivated gene A protein homolog RS21-C6 {Mouse (Mus musculus) [TaxId: 10090]}
rpfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwksdtepg
pqawppkeraalqeelsdvliylvalaarchvdlpqaviskmdt

SCOPe Domain Coordinates for d2oigd1:

Click to download the PDB-style file with coordinates for d2oigd1.
(The format of our PDB-style files is described here.)

Timeline for d2oigd1: