SCOPe 2.07: Domain d2oigc1: 2oig C:22-122

Lineage for d2oigc1 (2oig C:22-122)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.2: MazG-like [116993] (4 proteins)
   Pfam PF03819

6. Protein XTP3-transactivated gene A protein homolog RS21-C6 [140792] (1 species)
   confirmed prediction of the m5dCTPase activity

7. Species Mouse (Mus musculus) [TaxId:10090] [140793] (4 PDB entries)
   Uniprot Q9QY93 22-134

8. Domain d2oigc1: 2oig C:22-122 [139098]
   complexed with 523

Details for d2oigc1

PDB Entry: 2oig, 3.3 Å

PDB Description: crystal structure of rs21-c6 core segment and dm5ctp complex

PDB Compounds: (C:) rs21-c6

SCOPe Domain Sequences for d2oigc1:

Sequence, based on SEQRES records:

>d2oigc1 a.204.1.2 (C:22-122) XTP3-transactivated gene A protein homolog RS21-C6 {Mouse (Mus musculus) [TaxId: 10090]}
pfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwksdtepgp
qawppkeraalqeelsdvliylvalaarchvdlpqaviskm

Sequence, based on observed residues (ATOM records):

>d2oigc1 a.204.1.2 (C:22-122) XTP3-transactivated gene A protein homolog RS21-C6 {Mouse (Mus musculus) [TaxId: 10090]}
pfrfspeptledirrlhaqfhqprnlllalvgevgelaelfqwksdtgpqawppkeraal
qeelsdvliylvalaarchvdlpqaviskm

Timeline for d2oigc1:

• d2oigc1 first appeared in SCOP 1.73
  
• d2oigc1 appears in SCOPe 2.06
  
• d2oigc1 appears in the current release, SCOPe 2.08