Lineage for d2oi7b2 (2oi7 B:4-251)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841352Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 841353Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (19 families) (S)
  5. 841408Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (3 proteins)
  6. 841409Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain [53462] (2 species)
  7. 841410Species Escherichia coli [TaxId:562] [53463] (6 PDB entries)
  8. 841418Domain d2oi7b2: 2oi7 B:4-251 [139091]
    Other proteins in same PDB: d2oi7a1, d2oi7b1
    automatically matched to d1fwya2
    complexed with co, dca, gn1, mg, so4, ud1

Details for d2oi7b2

PDB Entry: 2oi7 (more details), 2.54 Å

PDB Description: e. coli glmu- complex with udp-glcnac, desulpho-coa and glcnac-1-po4
PDB Compounds: (B:) Bifunctional protein glmU

SCOP Domain Sequences for d2oi7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oi7b2 c.68.1.5 (B:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]}
namsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdllk
qalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakpq
ggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkrw
lakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqseq
aeklllag

SCOP Domain Coordinates for d2oi7b2:

Click to download the PDB-style file with coordinates for d2oi7b2.
(The format of our PDB-style files is described here.)

Timeline for d2oi7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oi7b1