Lineage for d2oi7a1 (2oi7 A:252-452)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809516Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 809517Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (8 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 809600Family b.81.1.4: GlmU C-terminal domain-like [51171] (3 proteins)
    this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain
  6. 809615Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (2 species)
  7. 809616Species Escherichia coli [TaxId:562] [51173] (6 PDB entries)
  8. 809623Domain d2oi7a1: 2oi7 A:252-452 [139088]
    Other proteins in same PDB: d2oi7a2, d2oi7b2
    automatically matched to d1hv9a1
    complexed with co, dca, gn1, mg, so4, ud1

Details for d2oi7a1

PDB Entry: 2oi7 (more details), 2.54 Å

PDB Description: e. coli glmu- complex with udp-glcnac, desulpho-coa and glcnac-1-po4
PDB Compounds: (A:) Bifunctional protein glmU

SCOP Domain Sequences for d2oi7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oi7a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]}
vmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsvigddceisp
ytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgskaghltylgdae
igdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgatiaagttvtrnv
genalaisrvpqtqkegwrrp

SCOP Domain Coordinates for d2oi7a1:

Click to download the PDB-style file with coordinates for d2oi7a1.
(The format of our PDB-style files is described here.)

Timeline for d2oi7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oi7a2