SCOPe 2.08: Domain d2oi7a1: 2oi7 A:252-452

Lineage for d2oi7a1 (2oi7 A:252-452)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins)
   this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain

6. Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (3 species)

7. Species Escherichia coli [TaxId:562] [51173] (6 PDB entries)

8. Domain d2oi7a1: 2oi7 A:252-452 [139088]
   Other proteins in same PDB: d2oi7a2, d2oi7b2
   automated match to d1hv9a1
   complexed with co, dca, gn1, mg, so4, ud1

Details for d2oi7a1

PDB Entry: 2oi7, 2.54 Å

PDB Description: e. coli glmu- complex with udp-glcnac, desulpho-coa and glcnac-1-po4

PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d2oi7a1:

Sequence; same for both SEQRES and ATOM records:

>d2oi7a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]}
vmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsvigddceisp
ytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgskaghltylgdae
igdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgatiaagttvtrnv
genalaisrvpqtqkegwrrp

Timeline for d2oi7a1:

• d2oi7a1 first appeared in SCOP 1.73
  
• d2oi7a1 appears in SCOPe 2.07