SCOP 1.73: Domain d2oi6b1: 2oi6 B:252-452

Lineage for d2oi6b1 (2oi6 B:252-452)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (7 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.4: GlmU C-terminal domain-like [51171] (3 proteins)
   this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain

6. Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (2 species)

7. Species Escherichia coli [TaxId:562] [51173] (6 PDB entries)

8. Domain d2oi6b1: 2oi6 B:252-452 [139086]
   Other proteins in same PDB: d2oi6a2, d2oi6b2
   automatically matched to d1hv9a1
   complexed with co, coa, gp1, mg, so4, ud1

Details for d2oi6b1

PDB Entry: 2oi6, 2.2 Å

PDB Description: e. coli glmu- complex with udp-glcnac, coa and glcn-1-po4

PDB Compounds: (B:) Bifunctional protein glmU

SCOP Domain Sequences for d2oi6b1:

Sequence; same for both SEQRES and ATOM records:

>d2oi6b1 b.81.1.4 (B:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]}
vmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsvigddceisp
ytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgskaghltylgdae
igdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgatiaagttvtrnv
genalaisrvpqtqkegwrrp

Timeline for d2oi6b1:

• d2oi6b1 is new in SCOP 1.73
  
• d2oi6b1 appears in SCOP 1.75
  
• d2oi6b1 appears in the current release, SCOPe 2.08