Lineage for d2oi6a1 (2oi6 A:252-453)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814014Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins)
    this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain
  6. 2814029Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (3 species)
  7. 2814030Species Escherichia coli [TaxId:562] [51173] (6 PDB entries)
  8. 2814035Domain d2oi6a1: 2oi6 A:252-453 [139084]
    Other proteins in same PDB: d2oi6a2, d2oi6b2
    automated match to d1hv9a1
    complexed with co, coa, gp1, mg, so4, ud1

Details for d2oi6a1

PDB Entry: 2oi6 (more details), 2.2 Å

PDB Description: e. coli glmu- complex with udp-glcnac, coa and glcn-1-po4
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d2oi6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oi6a1 b.81.1.4 (A:252-453) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]}
vmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsvigddceisp
ytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgskaghltylgdae
igdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgatiaagttvtrnv
genalaisrvpqtqkegwrrpv

SCOPe Domain Coordinates for d2oi6a1:

Click to download the PDB-style file with coordinates for d2oi6a1.
(The format of our PDB-style files is described here.)

Timeline for d2oi6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oi6a2