SCOPe 2.05: Domain d2ogqa1: 2ogq A:371-494

Lineage for d2ogqa1 (2ogq A:371-494)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.223: Polo-box domain [82614] (1 superfamily)
   beta(6)-alpha; antiparallel beta-sheet, meander

4. Superfamily d.223.1: Polo-box domain [82615] (2 families)
   Serine/threonine protein kinase-associated motif embedded in two distinct folds

5. Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
   duplication: consists of two polo-box domains; binds phosphothreonine peptide

6. Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102858] (17 PDB entries)

8. Domain d2ogqa1: 2ogq A:371-494 [139063]
   automated match to d3bzia1

Details for d2ogqa1

PDB Entry: 2ogq, 1.95 Å

PDB Description: Molecular and structural basis of Plk1 substrate recognition: Implications in centrosomal localization

PDB Compounds: (A:) Serine/threonine-protein kinase PLK1

SCOPe Domain Sequences for d2ogqa1:

Sequence; same for both SEQRES and ATOM records:

>d2ogqa1 d.223.1.2 (A:371-494) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dchlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkyglgyqlcdn
svgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfrnymsehl
lkag

Timeline for d2ogqa1:

• d2ogqa1 first appeared in SCOP 1.73
  
• d2ogqa1 appears in SCOPe 2.04
  
• d2ogqa1 appears in SCOPe 2.06
  
• d2ogqa1 appears in the current release, SCOPe 2.08