Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Lymphocyte kinase (lck) [56153] (1 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56154] (35 PDB entries) |
Domain d2og8b2: 2og8 B:237-499 [139062] Other proteins in same PDB: d2og8b3, d2og8b4 automated match to d1qpca_ complexed with 1n8 |
PDB Entry: 2og8 (more details), 2.3 Å
SCOPe Domain Sequences for d2og8b2:
Sequence, based on SEQRES records: (download)
>d2og8b2 d.144.1.7 (B:237-499) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} ewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaeanlmkqlq hqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafie ernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtapeainygt ftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrlc wkerpedrptfdylrsvledfft
>d2og8b2 d.144.1.7 (B:237-499) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} ewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaeanlmkqlq hqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafie ernyihrdlraanilvsdtlsckiadfglapikwtapeainygtftiksdvwsfgillte ivthgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrlcwkerpedrptfdylrs vledfft
Timeline for d2og8b2: