SCOP 1.75: Domain d2og0b1: 2og0 B:1-52

Lineage for d2og0b1 (2og0 B:1-52)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (7 families)

5. Family a.6.1.7: Excisionase-like [46891] (2 proteins)
   kinked C-terminal helix

6. Protein Excisionase Xis [89004] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [89005] (5 PDB entries)
   Uniprot P03699 1-55

8. Domain d2og0b1: 2og0 B:1-52 [139060]
   automatically matched to d1lx8a_
   mutant

Details for d2og0b1

PDB Entry: 2og0, 1.9 Å

PDB Description: crystal structure of the lambda xis-dna complex

PDB Compounds: (B:) Excisionase

SCOP Domain Sequences for d2og0b1:

Sequence; same for both SEQRES and ATOM records:

>d2og0b1 a.6.1.7 (B:1-52) Excisionase Xis {Bacteriophage lambda [TaxId: 10710]}
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdl

Timeline for d2og0b1:

• d2og0b1 first appeared in SCOP 1.73
  
• d2og0b1 appears in SCOPe 2.01
  
• d2og0b1 appears in the current release, SCOPe 2.08, called d2og0b_