Class a: All alpha proteins [46456] (258 folds) |
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
Superfamily a.6.1: Putative DNA-binding domain [46955] (7 families) |
Family a.6.1.7: Excisionase-like [46891] (2 proteins) kinked C-terminal helix |
Protein Excisionase Xis [89004] (1 species) |
Species Bacteriophage lambda [TaxId:10710] [89005] (5 PDB entries) |
Domain d2og0a1: 2og0 A:1-51 [139059] automatically matched to d1lx8a_ mutant |
PDB Entry: 2og0 (more details), 1.9 Å
SCOP Domain Sequences for d2og0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2og0a1 a.6.1.7 (A:1-51) Excisionase Xis {Bacteriophage lambda [TaxId: 10710]} myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvd
Timeline for d2og0a1: