SCOPe 2.01: Domain d2ofvb_: 2ofv B:

Lineage for d2ofvb_ (2ofv B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Lymphocyte kinase (lck) [56153] (1 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56154] (33 PDB entries)

8. Domain d2ofvb_: 2ofv B: [139058]
   automated match to d1qpca_
   complexed with 242

Details for d2ofvb_

PDB Entry: 2ofv, 2 Å

PDB Description: crystal structure of aminoquinazoline 1 bound to Lck

PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase LCK

SCOPe Domain Sequences for d2ofvb_:

Sequence, based on SEQRES records:

>d2ofvb_ d.144.1.7 (B:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}
pwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaeanl
mkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaeg
mafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtapea
inygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeelyq
lmrlcwkerpedrptfdylrsvledfft

Sequence, based on observed residues (ATOM records):

>d2ofvb_ d.144.1.7 (B:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}
pwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgaflaeanlmkqlq
hqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafie
ernyihrdlraanilvsdtlsckiadfglarliedpikwtapeainygtftiksdvwsfg
illteivthgripypiqnlegyrmvrpdncpeelyqlmrlcwkerpedrptfdylrsvle
dfft

Timeline for d2ofvb_:

• d2ofvb_ first appeared in SCOP 1.73, called d2ofvb1
  
• d2ofvb_ was called d2ofvb1 in SCOP 1.75
  
• d2ofvb_ appears in SCOPe 2.02
  
• d2ofvb_ appears in the current release, SCOPe 2.08, called d2ofvb2