Lineage for d2ofva2 (2ofv A:232-498)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219897Protein Lymphocyte kinase (lck) [56153] (1 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2219898Species Human (Homo sapiens) [TaxId:9606] [56154] (34 PDB entries)
  8. 2219922Domain d2ofva2: 2ofv A:232-498 [139057]
    Other proteins in same PDB: d2ofva3, d2ofvb3
    automated match to d1qpca_
    complexed with 242

Details for d2ofva2

PDB Entry: 2ofv (more details), 2 Å

PDB Description: crystal structure of aminoquinazoline 1 bound to Lck
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase LCK

SCOPe Domain Sequences for d2ofva2:

Sequence, based on SEQRES records: (download)

>d2ofva2 d.144.1.7 (A:232-498) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}
pwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaeanl
mkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaeg
mafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtapea
inygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeelyq
lmrlcwkerpedrptfdylrsvledff

Sequence, based on observed residues (ATOM records): (download)

>d2ofva2 d.144.1.7 (A:232-498) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}
pwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqglaeanlmkqlqhq
rlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafieer
nyihrdlraanilvsdtlsckiadfglaikwtapeainygtftiksdvwsfgillteivt
hgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrlcwkerpedrptfdylrsvle
dff

SCOPe Domain Coordinates for d2ofva2:

Click to download the PDB-style file with coordinates for d2ofva2.
(The format of our PDB-style files is described here.)

Timeline for d2ofva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ofva3