Lineage for d2ofva_ (2ofv A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1930748Protein Lymphocyte kinase (lck) [56153] (1 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 1930749Species Human (Homo sapiens) [TaxId:9606] [56154] (34 PDB entries)
  8. 1930773Domain d2ofva_: 2ofv A: [139057]
    automated match to d1qpca_
    complexed with 242

Details for d2ofva_

PDB Entry: 2ofv (more details), 2 Å

PDB Description: crystal structure of aminoquinazoline 1 bound to Lck
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase LCK

SCOPe Domain Sequences for d2ofva_:

Sequence, based on SEQRES records: (download)

>d2ofva_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}
kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
qlmrlcwkerpedrptfdylrsvledff

Sequence, based on observed residues (ATOM records): (download)

>d2ofva_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}
kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqglaeanlmkqlqh
qrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafiee
rnyihrdlraanilvsdtlsckiadfglaikwtapeainygtftiksdvwsfgillteiv
thgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrlcwkerpedrptfdylrsvl
edff

SCOPe Domain Coordinates for d2ofva_:

Click to download the PDB-style file with coordinates for d2ofva_.
(The format of our PDB-style files is described here.)

Timeline for d2ofva_: