![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Lymphocyte kinase (lck) [56153] (1 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56154] (35 PDB entries) |
![]() | Domain d2ofua_: 2ofu A: [139056] automated match to d1qpca_ complexed with 1n9, so4 |
PDB Entry: 2ofu (more details), 2 Å
SCOPe Domain Sequences for d2ofua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ofua_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} pqkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflae anlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqi aegmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwta peainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpee lyqlmrlcwkerpedrptfdylrsvledfftat
Timeline for d2ofua_: