SCOPe 2.08: Domain d2ofpa1: 2ofp A:168-292

Lineage for d2ofpa1 (2ofp A:168-292)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.7: Ketopantoate reductase PanE [69084] (1 protein)
   automatically mapped to Pfam PF08546

6. Protein Ketopantoate reductase PanE [69085] (1 species)

7. Species Escherichia coli [TaxId:562] [69086] (4 PDB entries)

8. Domain d2ofpa1: 2ofp A:168-292 [139052]
   Other proteins in same PDB: d2ofpa2, d2ofpa3, d2ofpb2, d2ofpb3
   automated match to d1ks9a1
   complexed with act, dio, nap, paf

Details for d2ofpa1

PDB Entry: 2ofp, 2.3 Å

PDB Description: Crystal structure of Escherichia coli ketopantoate reductase in a ternary complex with NADP+ and pantoate

PDB Compounds: (A:) Ketopantoate reductase

SCOPe Domain Sequences for d2ofpa1:

Sequence; same for both SEQRES and ATOM records:

>d2ofpa1 a.100.1.7 (A:168-292) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]}
niraelwrklavncvinpltaiwncpngelrhhpqeimqiceevaaviereghhtsaedl
rdyvmqvidataenissmlqdiralrhteidyingfllrrarahgiavpentrlfemvkr
kesey

Timeline for d2ofpa1:

• d2ofpa1 first appeared in SCOP 1.73
  
• d2ofpa1 appears in SCOPe 2.07