Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
Protein O-succinylbenzoate synthase [54834] (1 species) |
Species Escherichia coli [TaxId:562] [54835] (4 PDB entries) |
Domain d2ofjd2: 2ofj D:1-99 [139051] Other proteins in same PDB: d2ofja1, d2ofjb1, d2ofjc1, d2ofjd1 automated match to d1r6wa2 mutant |
PDB Entry: 2ofj (more details), 2.3 Å
SCOPe Domain Sequences for d2ofjd2:
Sequence, based on SEQRES records: (download)
>d2ofjd2 d.54.1.1 (D:1-99) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]} mrsaqvyrwqipmdagvvlrdrrlktrdglyvclregeregwgeisplpgfsqetweeaq svllawvnnwlagdcelpqmpsvafgvscalaeltdtlp
>d2ofjd2 d.54.1.1 (D:1-99) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]} mrsaqvyrwqipmlktrdglyvclregeregwgeisplpgfsqetweeaqsvllawvnnw lagdcelpqmpsvafgvscalaeltdtlp
Timeline for d2ofjd2: