SCOPe 2.07: Domain d2ofjc2: 2ofj C:1-99

Lineage for d2ofjc2 (2ofj C:1-99)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein O-succinylbenzoate synthase [54834] (1 species)

7. Species Escherichia coli [TaxId:562] [54835] (4 PDB entries)

8. Domain d2ofjc2: 2ofj C:1-99 [139049]
   Other proteins in same PDB: d2ofja1, d2ofjb1, d2ofjc1, d2ofjd1
   automated match to d1r6wa2
   mutant

Details for d2ofjc2

PDB Entry: 2ofj, 2.3 Å

PDB Description: crystal structure of the e190a mutant of o-succinylbenzoate synthase from escherichia coli

PDB Compounds: (C:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d2ofjc2:

Sequence, based on SEQRES records:

>d2ofjc2 d.54.1.1 (C:1-99) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]}
mrsaqvyrwqipmdagvvlrdrrlktrdglyvclregeregwgeisplpgfsqetweeaq
svllawvnnwlagdcelpqmpsvafgvscalaeltdtlp

Sequence, based on observed residues (ATOM records):

>d2ofjc2 d.54.1.1 (C:1-99) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]}
mrsaqvyrwqipmdlktrdglyvclregeregwgeisplpgfsqetweeaqsvllawvnn
wlagdcelpqmpsvafgvscalaeltdtlp

Timeline for d2ofjc2:

• d2ofjc2 first appeared in SCOP 1.73
  
• d2ofjc2 appears in SCOPe 2.06
  
• d2ofjc2 appears in the current release, SCOPe 2.08