Lineage for d2ofja2 (2ofj A:1-99)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722893Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 722894Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 722895Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 723110Protein O-succinylbenzoate synthase [54834] (1 species)
  7. 723111Species Escherichia coli [TaxId:562] [54835] (4 PDB entries)
  8. 723115Domain d2ofja2: 2ofj A:1-99 [139045]
    Other proteins in same PDB: d2ofja1, d2ofjb1, d2ofjc1, d2ofjd1
    automatically matched to d1fhva2
    mutant

Details for d2ofja2

PDB Entry: 2ofj (more details), 2.3 Å

PDB Description: crystal structure of the e190a mutant of o-succinylbenzoate synthase from escherichia coli
PDB Compounds: (A:) o-succinylbenzoate synthase

SCOP Domain Sequences for d2ofja2:

Sequence, based on SEQRES records: (download)

>d2ofja2 d.54.1.1 (A:1-99) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]}
mrsaqvyrwqipmdagvvlrdrrlktrdglyvclregeregwgeisplpgfsqetweeaq
svllawvnnwlagdcelpqmpsvafgvscalaeltdtlp

Sequence, based on observed residues (ATOM records): (download)

>d2ofja2 d.54.1.1 (A:1-99) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]}
mrsaqvyrwqipmdrrlktrdglyvclregeregwgeisplpgfsqetweeaqsvllawv
nnwlagdcelpqmpsvafgvscalaeltdtlp

SCOP Domain Coordinates for d2ofja2:

Click to download the PDB-style file with coordinates for d2ofja2.
(The format of our PDB-style files is described here.)

Timeline for d2ofja2: