Lineage for d2ofja2 (2ofj A:1-99)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947583Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2947850Protein O-succinylbenzoate synthase [54834] (1 species)
  7. 2947851Species Escherichia coli [TaxId:562] [54835] (4 PDB entries)
  8. 2947855Domain d2ofja2: 2ofj A:1-99 [139045]
    Other proteins in same PDB: d2ofja1, d2ofjb1, d2ofjc1, d2ofjd1
    automated match to d1r6wa2
    mutant

Details for d2ofja2

PDB Entry: 2ofj (more details), 2.3 Å

PDB Description: crystal structure of the e190a mutant of o-succinylbenzoate synthase from escherichia coli
PDB Compounds: (A:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d2ofja2:

Sequence, based on SEQRES records: (download)

>d2ofja2 d.54.1.1 (A:1-99) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]}
mrsaqvyrwqipmdagvvlrdrrlktrdglyvclregeregwgeisplpgfsqetweeaq
svllawvnnwlagdcelpqmpsvafgvscalaeltdtlp

Sequence, based on observed residues (ATOM records): (download)

>d2ofja2 d.54.1.1 (A:1-99) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]}
mrsaqvyrwqipmdrrlktrdglyvclregeregwgeisplpgfsqetweeaqsvllawv
nnwlagdcelpqmpsvafgvscalaeltdtlp

SCOPe Domain Coordinates for d2ofja2:

Click to download the PDB-style file with coordinates for d2ofja2.
(The format of our PDB-style files is described here.)

Timeline for d2ofja2: