Lineage for d2of4a_ (2of4 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1043097Protein Lymphocyte kinase (lck) [56153] (1 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 1043098Species Human (Homo sapiens) [TaxId:9606] [56154] (33 PDB entries)
  8. 1043133Domain d2of4a_: 2of4 A: [139043]
    automated match to d1qpca_
    complexed with 979

Details for d2of4a_

PDB Entry: 2of4 (more details), 2.7 Å

PDB Description: crystal structure of furanopyrimidine 1 bound to lck
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase LCK

SCOPe Domain Sequences for d2of4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2of4a_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}
kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
qlmrlcwkerpedrptfdylrsvledfftat

SCOPe Domain Coordinates for d2of4a_:

Click to download the PDB-style file with coordinates for d2of4a_.
(The format of our PDB-style files is described here.)

Timeline for d2of4a_: