SCOP 1.73: Domain d2oeng1: 2oen G:58-332

Lineage for d2oeng1 (2oen G:58-332)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins)

6. Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (1 species)

7. Species Bacillus megaterium [TaxId:1404] [117741] (9 PDB entries)

8. Domain d2oeng1: 2oen G:58-332 [139039]
   Other proteins in same PDB: d2oenl1
   automatically matched to d1sxga_

Details for d2oeng1

PDB Entry: 2oen, 3.17 Å

PDB Description: Structural mechanism for the fine-tuning of CcpA function by the small molecule effectors glucose-6-phosphate and fructose-1,6-bisphosphate

PDB Compounds: (G:) Catabolite control protein

SCOP Domain Sequences for d2oeng1:

Sequence; same for both SEQRES and ATOM records:

>d2oeng1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
kktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqv
dgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsgh
kniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleed
ekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydi
gavamrlltkymnketvdssivqlphriefrqstk

Timeline for d2oeng1:

• d2oeng1 is new in SCOP 1.73
  
• d2oeng1 appears in SCOP 1.75
  
• d2oeng1 appears in the current release, SCOPe 2.08, called d2oeng_