SCOPe 2.04: Domain d2oeda_: 2oed A:

Lineage for d2oeda_ (2oed A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (3 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (32 PDB entries)

8. Domain d2oeda_: 2oed A: [139038]
   automated match to d1p7fa_

Details for d2oeda_

PDB Entry: 2oed

PDB Description: gb3 solution structure obtained by refinement of x-ray structure with dipolar couplings

PDB Compounds: (A:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d2oeda_:

Sequence; same for both SEQRES and ATOM records:

>d2oeda_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mqyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvte

Timeline for d2oeda_:

• d2oeda_ first appeared in SCOP 1.73, called d2oeda1
  
• d2oeda_ was called d2oeda1 in SCOPe 2.03
  
• d2oeda_ appears in SCOPe 2.05
  
• d2oeda_ appears in the current release, SCOPe 2.08, called d2oeda2