Lineage for d2odkd1 (2odk D:1-51)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1231574Fold d.306: YefM-like [143119] (1 superfamily)
    core: beta-alpha(2)-beta(2)-alpha; mixed beta-sheet, order:123, strands 1 and 2 are parallel; forms compact dimer with a single beta-sheet;
  4. 1231575Superfamily d.306.1: YefM-like [143120] (2 families) (S)
  5. 1231576Family d.306.1.1: YefM-like [143121] (2 proteins)
    antitoxin component of the YefM/YoeB-like system; binds to the toxin component wia extra C-terminal tail, unstructured in the free state, but adopting a RelB-like conformation in the bound state
  6. 1231583Protein Hypothetical protein NE2111 [143124] (1 species)
  7. 1231584Species Nitrosomonas europaea [TaxId:915] [143125] (1 PDB entry)
    Uniprot Q82T22 1-51
  8. 1231588Domain d2odkd1: 2odk D:1-51 [139033]
    automatically matched to 2ODK A:1-51
    complexed with gol, so4

Details for d2odkd1

PDB Entry: 2odk (more details), 1.4 Å

PDB Description: Putative prevent-host-death protein from Nitrosomonas europaea
PDB Compounds: (D:) hypothetical protein

SCOPe Domain Sequences for d2odkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2odkd1 d.306.1.1 (D:1-51) Hypothetical protein NE2111 {Nitrosomonas europaea [TaxId: 915]}
mhvwpvqdakarfsefldacitegpqivsrrgaeeavlvpigewrrlqaaa

SCOPe Domain Coordinates for d2odkd1:

Click to download the PDB-style file with coordinates for d2odkd1.
(The format of our PDB-style files is described here.)

Timeline for d2odkd1: