SCOPe 2.08: Domain d2odkd2: 2odk D:1-51

Lineage for d2odkd2 (2odk D:1-51)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.306: YefM-like [143119] (1 superfamily)
   core: beta-alpha(2)-beta(2)-alpha; mixed beta-sheet, order:123, strands 1 and 2 are parallel; forms compact dimer with a single beta-sheet;

4. Superfamily d.306.1: YefM-like [143120] (2 families)

5. Family d.306.1.1: YefM-like [143121] (2 proteins)
   antitoxin component of the YefM/YoeB-like system; binds to the toxin component wia extra C-terminal tail, unstructured in the free state, but adopting a RelB-like conformation in the bound state
   automatically mapped to Pfam PF02604

6. Protein Hypothetical protein NE2111 [143124] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [143125] (1 PDB entry)
   Uniprot Q82T22 1-51

8. Domain d2odkd2: 2odk D:1-51 [139033]
   Other proteins in same PDB: d2odkd3
   automated match to d2odka1
   complexed with gol, so4

Details for d2odkd2

PDB Entry: 2odk, 1.4 Å

PDB Description: Putative prevent-host-death protein from Nitrosomonas europaea

PDB Compounds: (D:) hypothetical protein

SCOPe Domain Sequences for d2odkd2:

Sequence; same for both SEQRES and ATOM records:

>d2odkd2 d.306.1.1 (D:1-51) Hypothetical protein NE2111 {Nitrosomonas europaea [TaxId: 915]}
mhvwpvqdakarfsefldacitegpqivsrrgaeeavlvpigewrrlqaaa

Timeline for d2odkd2:

• d2odkd2 first appeared in SCOP 1.73, called d2odkd1
  
• d2odkd2 appears in SCOPe 2.07