![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies) helix-extended loop-helix; parallel helices |
![]() | Superfamily a.140.1: LEM domain [63451] (1 family) ![]() |
![]() | Family a.140.1.1: LEM domain [63452] (3 proteins) |
![]() | Protein Inner nuclear membrane protein emerin [63455] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63456] (5 PDB entries) |
![]() | Domain d2odgc2: 2odg C:2-47 [139029] Other proteins in same PDB: d2odga_, d2odgb_, d2odgc3 automated match to d1jeia_ |
PDB Entry: 2odg (more details)
SCOPe Domain Sequences for d2odgc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2odgc2 a.140.1.1 (C:2-47) Inner nuclear membrane protein emerin {Human (Homo sapiens) [TaxId: 9606]} dnyadlsdtelttllrryniphgpvvgstrrlyekkifeyetqrrr
Timeline for d2odgc2: