| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies) helix-extended loop-helix; parallel helices |
Superfamily a.140.1: LEM domain [63451] (1 family) ![]() |
| Family a.140.1.1: LEM domain [63452] (2 proteins) |
| Protein Inner nuclear membrane protein emerin [63455] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [63456] (3 PDB entries) |
| Domain d2odgc_: 2odg C: [139029] Other proteins in same PDB: d2odga_, d2odgb_ automated match to d1jeia_ |
PDB Entry: 2odg (more details)
SCOPe Domain Sequences for d2odgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2odgc_ a.140.1.1 (C:) Inner nuclear membrane protein emerin {Human (Homo sapiens) [TaxId: 9606]}
hdnyadlsdtelttllrryniphgpvvgstrrlyekkifeyetqrrr
Timeline for d2odgc_: