Lineage for d2odgc1 (2odg C:2-47)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649863Fold a.140: LEM/SAP HeH motif [63450] (5 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 649864Superfamily a.140.1: LEM domain [63451] (1 family) (S)
  5. 649865Family a.140.1.1: LEM domain [63452] (2 proteins)
  6. 649866Protein Inner nuclear membrane protein emerin [63455] (1 species)
  7. 649867Species Human (Homo sapiens) [TaxId:9606] [63456] (3 PDB entries)
  8. 649868Domain d2odgc1: 2odg C:2-47 [139029]
    Other proteins in same PDB: d2odga1, d2odgb1
    automatically matched to d1jeia_

Details for d2odgc1

PDB Entry: 2odg (more details)

PDB Description: complex of barrier-to-autointegration factor and lem-domain of emerin
PDB Compounds: (C:) emerin

SCOP Domain Sequences for d2odgc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2odgc1 a.140.1.1 (C:2-47) Inner nuclear membrane protein emerin {Human (Homo sapiens) [TaxId: 9606]}
dnyadlsdtelttllrryniphgpvvgstrrlyekkifeyetqrrr

SCOP Domain Coordinates for d2odgc1:

Click to download the PDB-style file with coordinates for d2odgc1.
(The format of our PDB-style files is described here.)

Timeline for d2odgc1: