Lineage for d2odgc2 (2odg C:2-47)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734562Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 2734563Superfamily a.140.1: LEM domain [63451] (1 family) (S)
  5. 2734564Family a.140.1.1: LEM domain [63452] (3 proteins)
  6. 2734565Protein Inner nuclear membrane protein emerin [63455] (1 species)
  7. 2734566Species Human (Homo sapiens) [TaxId:9606] [63456] (5 PDB entries)
  8. 2734570Domain d2odgc2: 2odg C:2-47 [139029]
    Other proteins in same PDB: d2odga_, d2odgb_, d2odgc3
    automated match to d1jeia_

Details for d2odgc2

PDB Entry: 2odg (more details)

PDB Description: complex of barrier-to-autointegration factor and lem-domain of emerin
PDB Compounds: (C:) emerin

SCOPe Domain Sequences for d2odgc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2odgc2 a.140.1.1 (C:2-47) Inner nuclear membrane protein emerin {Human (Homo sapiens) [TaxId: 9606]}
dnyadlsdtelttllrryniphgpvvgstrrlyekkifeyetqrrr

SCOPe Domain Coordinates for d2odgc2:

Click to download the PDB-style file with coordinates for d2odgc2.
(The format of our PDB-style files is described here.)

Timeline for d2odgc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2odgc3