| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (1 protein) |
| Protein Barrier-to-autointegration factor, BAF [47800] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47801] (7 PDB entries) |
| Domain d2odgb1: 2odg B:1-89 [139028] Other proteins in same PDB: d2odgc1 automatically matched to d1ci4a_ |
PDB Entry: 2odg (more details)
SCOP Domain Sequences for d2odgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2odgb1 a.60.5.1 (B:1-89) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]}
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl
Timeline for d2odgb1: