Lineage for d2odci2 (2odc I:2-47)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347594Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 2347595Superfamily a.140.1: LEM domain [63451] (1 family) (S)
  5. 2347596Family a.140.1.1: LEM domain [63452] (3 proteins)
  6. 2347597Protein Inner nuclear membrane protein emerin [63455] (1 species)
  7. 2347598Species Human (Homo sapiens) [TaxId:9606] [63456] (5 PDB entries)
  8. 2347603Domain d2odci2: 2odc I:2-47 [139026]
    Other proteins in same PDB: d2odci3
    automated match to d1jeia_

Details for d2odci2

PDB Entry: 2odc (more details)

PDB Description: lem-domain of the nuclear envelope protein emerin
PDB Compounds: (I:) emerin

SCOPe Domain Sequences for d2odci2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2odci2 a.140.1.1 (I:2-47) Inner nuclear membrane protein emerin {Human (Homo sapiens) [TaxId: 9606]}
dnyadlsdtelttllrryniphgpvvgstrrlyekkifeyetqrrr

SCOPe Domain Coordinates for d2odci2:

Click to download the PDB-style file with coordinates for d2odci2.
(The format of our PDB-style files is described here.)

Timeline for d2odci2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2odci3