SCOPe 2.08: Domain d2odci2: 2odc I:2-47

Lineage for d2odci2 (2odc I:2-47)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
   helix-extended loop-helix; parallel helices

4. Superfamily a.140.1: LEM domain [63451] (1 family)

5. Family a.140.1.1: LEM domain [63452] (3 proteins)

6. Protein Inner nuclear membrane protein emerin [63455] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63456] (5 PDB entries)

8. Domain d2odci2: 2odc I:2-47 [139026]
   Other proteins in same PDB: d2odci3
   automated match to d1jeia_

Details for d2odci2

PDB Entry: 2odc

PDB Description: lem-domain of the nuclear envelope protein emerin

PDB Compounds: (I:) emerin

SCOPe Domain Sequences for d2odci2:

Sequence; same for both SEQRES and ATOM records:

>d2odci2 a.140.1.1 (I:2-47) Inner nuclear membrane protein emerin {Human (Homo sapiens) [TaxId: 9606]}
dnyadlsdtelttllrryniphgpvvgstrrlyekkifeyetqrrr

Timeline for d2odci2:

• d2odci2 first appeared in SCOP 1.73, called d2odci1
  
• d2odci2 appears in SCOPe 2.07