SCOP 1.73: Domain d2od8a2: 2od8 A:127-255

Lineage for d2od8a2 (2od8 A:127-255)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (4 PDB entries)

8. Domain d2od8a2: 2od8 A:127-255 [139025]
   automatically matched to d1plq_2

Details for d2od8a2

PDB Entry: 2od8, 2.8 Å

PDB Description: structure of a peptide derived from cdc9 bound to pcna

PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOP Domain Sequences for d2od8a2:

Sequence; same for both SEQRES and ATOM records:

>d2od8a2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkfn

Timeline for d2od8a2:

• d2od8a2 is new in SCOP 1.73
  
• d2od8a2 appears in SCOP 1.75
  
• d2od8a2 appears in the current release, SCOPe 2.08