Lineage for d2od8a2 (2od8 A:127-255)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977007Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2977029Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2977037Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (8 PDB entries)
    Uniprot P15873
  8. 2977055Domain d2od8a2: 2od8 A:127-255 [139025]
    automatically matched to d1plq_2

Details for d2od8a2

PDB Entry: 2od8 (more details), 2.8 Å

PDB Description: structure of a peptide derived from cdc9 bound to pcna
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d2od8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2od8a2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkfn

SCOPe Domain Coordinates for d2od8a2:

Click to download the PDB-style file with coordinates for d2od8a2.
(The format of our PDB-style files is described here.)

Timeline for d2od8a2: