![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Rab-related protein Sec4 [52607] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52608] (3 PDB entries) |
![]() | Domain d2ocyc1: 2ocy C:18-186 [139023] Other proteins in same PDB: d2ocya1, d2ocya2, d2ocyb1, d2ocyb2 |
PDB Entry: 2ocy (more details), 3.3 Å
SCOPe Domain Sequences for d2ocyc1:
Sequence, based on SEQRES records: (download)
>d2ocyc1 c.37.1.8 (C:18-186) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dsimkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqlwdta gqerfrtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksdm etrvvtadqgealakelgipfiessaknddnvneifftlakliqekids
>d2ocyc1 c.37.1.8 (C:18-186) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dsimkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdklqlwdtagqerfr tittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgdqgealakelg ipfiessanvneifftlakliqekids
Timeline for d2ocyc1:
![]() Domains from other chains: (mouse over for more information) d2ocya1, d2ocya2, d2ocyb1, d2ocyb2 |