SCOP 1.75: Domain d2ocyc1: 2ocy C:18-186

Lineage for d2ocyc1 (2ocy C:18-186)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab-related protein Sec4 [52607] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52608] (5 PDB entries)

8. Domain d2ocyc1: 2ocy C:18-186 [139023]
   Other proteins in same PDB: d2ocya1, d2ocyb1

Details for d2ocyc1

PDB Entry: 2ocy, 3.3 Å

PDB Description: complex of the guanine exchange factor sec2p and the rab gtpase sec4p

PDB Compounds: (C:) Ras-related protein SEC4

SCOP Domain Sequences for d2ocyc1:

Sequence, based on SEQRES records:

>d2ocyc1 c.37.1.8 (C:18-186) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dsimkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqlwdta
gqerfrtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksdm
etrvvtadqgealakelgipfiessaknddnvneifftlakliqekids

Sequence, based on observed residues (ATOM records):

>d2ocyc1 c.37.1.8 (C:18-186) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dsimkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdklqlwdtagqerfr
tittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgdqgealakelg
ipfiessanvneifftlakliqekids

Timeline for d2ocyc1:

• d2ocyc1 first appeared in SCOP 1.73
  
• d2ocyc1 appears in SCOPe 2.01
  
• d2ocyc1 appears in the current release, SCOPe 2.08