Lineage for d2ocyc1 (2ocy C:18-186)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 696051Protein Rab-related protein Sec4 [52607] (1 species)
  7. 696052Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52608] (4 PDB entries)
  8. 696060Domain d2ocyc1: 2ocy C:18-186 [139023]
    Other proteins in same PDB: d2ocya1, d2ocyb1

Details for d2ocyc1

PDB Entry: 2ocy (more details), 3.3 Å

PDB Description: complex of the guanine exchange factor sec2p and the rab gtpase sec4p
PDB Compounds: (C:) Ras-related protein SEC4

SCOP Domain Sequences for d2ocyc1:

Sequence, based on SEQRES records: (download)

>d2ocyc1 c.37.1.8 (C:18-186) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dsimkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqlwdta
gqerfrtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksdm
etrvvtadqgealakelgipfiessaknddnvneifftlakliqekids

Sequence, based on observed residues (ATOM records): (download)

>d2ocyc1 c.37.1.8 (C:18-186) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dsimkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdklqlwdtagqerfr
tittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgdqgealakelg
ipfiessanvneifftlakliqekids

SCOP Domain Coordinates for d2ocyc1:

Click to download the PDB-style file with coordinates for d2ocyc1.
(The format of our PDB-style files is described here.)

Timeline for d2ocyc1: