Lineage for d2oc2a1 (2oc2 A:40-618)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729182Family d.92.1.5: Neurolysin-like [55505] (4 proteins)
    combines M2, M3 and M32 families of metalloproteases
    the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain
  6. 729189Protein Angiotensin converting enzyme, ACE [82733] (2 species)
    M2 family member; overall fold is similar to that of neurolysin but is less elaborated
  7. 729197Species Human (Homo sapiens) [TaxId:9606] [82734] (5 PDB entries)
  8. 729202Domain d2oc2a1: 2oc2 A:40-618 [139007]
    automatically matched to d1o86a_
    complexed with cl, rx3, zn

Details for d2oc2a1

PDB Entry: 2oc2 (more details), 2.25 Å

PDB Description: Structure of testis ACE with RXPA380
PDB Compounds: (A:) Angiotensin-converting enzyme, somatic isoform

SCOP Domain Sequences for d2oc2a1:

Sequence, based on SEQRES records: (download)

>d2oc2a1 d.92.1.5 (A:40-618) Angiotensin converting enzyme, ACE {Human (Homo sapiens) [TaxId: 9606]}
deaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqa
rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpngscl
qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds
wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw
aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwnks
mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv
alreganpgfheaigdvlalsvstpkhlhslnllsseggsdehdinflmkmaldkiafip
fsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvp
yiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamq
litgqpnmsasamlsyfkplldwlrtenelhgeklgwpq

Sequence, based on observed residues (ATOM records): (download)

>d2oc2a1 d.92.1.5 (A:40-618) Angiotensin converting enzyme, ACE {Human (Homo sapiens) [TaxId: 9606]}
deaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqa
rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpngscl
qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds
wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw
aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwnks
mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv
alreganpgfheaigdvlalsvstpkhlhslnllssggsdehdinflmkmaldkiafipf
sylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvpy
iryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamql
itgqpnmsasamlsyfkplldwlrtenelhgeklgwpq

SCOP Domain Coordinates for d2oc2a1:

Click to download the PDB-style file with coordinates for d2oc2a1.
(The format of our PDB-style files is described here.)

Timeline for d2oc2a1: