SCOP 1.73: Domain d2obja1: 2obj A:33-305

Lineage for d2obja1 (2obj A:33-305)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
   OPK group(?); PIM subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [118134] (4 PDB entries)

8. Domain d2obja1: 2obj A:33-305 [139006]
   automatically matched to d1xqza_
   complexed with vrv

Details for d2obja1

PDB Entry: 2obj, 2.5 Å

PDB Description: Crystal structure of human PIM-1 Kinase in complex with inhibitor

PDB Compounds: (A:) Proto-oncogene serine/threonine-protein kinase Pim-1

SCOP Domain Sequences for d2obja1:

Sequence; same for both SEQRES and ATOM records:

>d2obja1 d.144.1.7 (A:33-305) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
lrpsdrptfeeiqnhpwmqdvllpqetaeihlh

Timeline for d2obja1:

• d2obja1 is new in SCOP 1.73
  
• d2obja1 appears in SCOP 1.75
  
• d2obja1 appears in the current release, SCOPe 2.08, called d2obja_